General Information

  • ID:  hor007062
  • Uniprot ID:  P55095
  • Protein name:  Oxyntomodulin
  • Gene name:  CCL14; NCC2, SCYA14;
  • Organism:  Mus musculus
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1; GLP-2; oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus.
  • GO MF:  GO:0005737 cytoplasm; GO:0005615 extracellular space; GO:0005886 plasma membrane; GO:0034774 secretory granule lumen
  • GO BP:  GO:0031769 glucagon receptor binding; GO:0005179 hormone activity; GO:0042802 identical protein binding; GO:0048018 receptor ligand activity
  • GO CC:  GO:0010737 protein kinase A signaling; GO:0014823 response to activity; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway; GO:0071377 cellular response to glucagon stimulus; GO:0050796 regulation of insulin secretion; GO:0042593 glucose homeostasis; GO:0043066 negative regulation of apoptotic process; GO:0032099 negative regulation of appetite; GO:1900118 negative regulation of execution phase of apoptosis; GO:0090280 positive regulation of calcium ion import; GO:0045722 positive regulation of gluconeogenesis; GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus; GO:0033138 positive regulation of peptidyl-serine phosphorylation; GO:0010800 positive regulation of peptidyl-threonine phosphorylation; GO:0032092 positive regulation of protein binding; GO:0045860 positive regulation of protein kinase activity; GO:0006094 gl

Sequence Information

  • Sequence:  KRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
  • Length:  39
  • Propeptide:  MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAEELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK
  • Signal peptide:  MKTIYFVAGLLIMLVQGSWQ
  • Modification:  T4 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life / Aliphatic Index: Aliphatic Index:
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA